SCOPe 2.08: Domain d1hx8a1: 1hx8 A:167-299

Lineage for d1hx8a1 (1hx8 A:167-299)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (3 families)

5. Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins)
   this domain is associated with the N-terminal ENTH-like domain

6. Protein AP180 (Lap) [100932] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100933] (1 PDB entry)

8. Domain d1hx8a1: 1hx8 A:167-299 [90362]
   Other proteins in same PDB: d1hx8a2, d1hx8b2
   complexed with so4

Details for d1hx8a1

PDB Entry: 1hx8, 2.2 Å

PDB Description: crystal structure of n-terminal domain of drosophila ap180

PDB Compounds: (A:) synapse-enriched clathrin adaptor protein lap

SCOPe Domain Sequences for d1hx8a1:

Sequence; same for both SEQRES and ATOM records:

>d1hx8a1 a.7.8.2 (A:167-299) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
egslrsmnaekllktlpvlqaqldallefdcqsndlsngvinmsfmllfrdlirlfacyn
dgiinllekyfdmnkkhardaldlykkflvrmdrvgeflkvaenvgidkgdipdltkaps
slldaleqhlatl

Timeline for d1hx8a1:

• d1hx8a1 first appeared in SCOP 1.67
  
• d1hx8a1 appears in SCOPe 2.07