![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.8: GAT-like domain [89009] (3 families) ![]() |
![]() | Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins) this domain is associated with the N-terminal ENTH-like domain |
![]() | Protein AP180 (Lap) [100932] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100933] (1 PDB entry) |
![]() | Domain d1hx8a1: 1hx8 A:167-299 [90362] Other proteins in same PDB: d1hx8a2, d1hx8b2 complexed with so4 |
PDB Entry: 1hx8 (more details), 2.2 Å
SCOPe Domain Sequences for d1hx8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hx8a1 a.7.8.2 (A:167-299) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} egslrsmnaekllktlpvlqaqldallefdcqsndlsngvinmsfmllfrdlirlfacyn dgiinllekyfdmnkkhardaldlykkflvrmdrvgeflkvaenvgidkgdipdltkaps slldaleqhlatl
Timeline for d1hx8a1: