SCOPe 2.08: Domain d1hx8a2: 1hx8 A:22-161

Lineage for d1hx8a2 (1hx8 A:22-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins)

6. Protein AP180 (Lap) [100914] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [100915] (1 PDB entry)

8. Domain d1hx8a2: 1hx8 A:22-161 [90363]
   Other proteins in same PDB: d1hx8a1, d1hx8b1
   complexed with so4

Details for d1hx8a2

PDB Entry: 1hx8, 2.2 Å

PDB Description: crystal structure of n-terminal domain of drosophila ap180

PDB Compounds: (A:) synapse-enriched clathrin adaptor protein lap

SCOPe Domain Sequences for d1hx8a2:

Sequence, based on SEQRES records:

>d1hx8a2 a.118.9.3 (A:22-161) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtvqdggmgvpggrmgydmspfirrya
kylnekslsyramafdfckv

Sequence, based on observed residues (ATOM records):

>d1hx8a2 a.118.9.3 (A:22-161) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
itthhlmaygnerfmqylassnstfnlssfldkgtggmgvpggrmgydmspfirryakyl
nekslsyramafdfckv

Timeline for d1hx8a2:

• d1hx8a2 first appeared in SCOP 1.67
  
• d1hx8a2 appears in SCOPe 2.07