Lineage for d1pv4b1 (1pv4 B:51-126)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297600Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 297665Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 297666Species Escherichia coli [TaxId:562] [68911] (6 PDB entries)
  8. 297680Domain d1pv4b1: 1pv4 B:51-126 [88298]
    Other proteins in same PDB: d1pv4a1, d1pv4a3, d1pv4b2, d1pv4c1, d1pv4c3, d1pv4d1, d1pv4d3, d1pv4e1, d1pv4e3, d1pv4f1, d1pv4f3

Details for d1pv4b1

PDB Entry: 1pv4 (more details), 3 Å

PDB Description: x-ray crystal structure of the rho transcription termination factor in complex with single stranded dna
PDB Compounds: (B:)

SCOP Domain Sequences for d1pv4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv4b1 b.40.4.5 (B:51-126) Rho termination factor, RNA-binding domain {Escherichia coli}
gdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegery
fallkvnevnfdkpen

SCOP Domain Coordinates for d1pv4b1:

Click to download the PDB-style file with coordinates for d1pv4b1.
(The format of our PDB-style files is described here.)

Timeline for d1pv4b1: