SCOP 1.65: Domain d1pv4b1: 1pv4 B:51-126

Lineage for d1pv4b1 (1pv4 B:51-126)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
   barrel, closed; n=5, S=8

6. Protein Rho termination factor, RNA-binding domain [68910] (1 species)

7. Species Escherichia coli [TaxId:562] [68911] (6 PDB entries)

8. Domain d1pv4b1: 1pv4 B:51-126 [88298]
   Other proteins in same PDB: d1pv4a1, d1pv4a3, d1pv4b2, d1pv4c1, d1pv4c3, d1pv4d1, d1pv4d3, d1pv4e1, d1pv4e3, d1pv4f1, d1pv4f3

Details for d1pv4b1

PDB Entry: 1pv4, 3 Å

PDB Description: x-ray crystal structure of the rho transcription termination factor in complex with single stranded dna

SCOP Domain Sequences for d1pv4b1:

Sequence; same for both SEQRES and ATOM records:

>d1pv4b1 b.40.4.5 (B:51-126) Rho termination factor, RNA-binding domain {Escherichia coli}
gdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegery
fallkvnevnfdkpen

Timeline for d1pv4b1:

• d1pv4b1 is new in SCOP 1.65
  
• d1pv4b1 appears in SCOP 1.67
  
• d1pv4b1 appears in the current release, SCOPe 2.08