Lineage for d1pv4a1 (1pv4 A:1-47)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286517Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 286542Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 286543Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 286544Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 286545Species Escherichia coli [TaxId:562] [50295] (6 PDB entries)
  8. 286557Domain d1pv4a1: 1pv4 A:1-47 [88295]
    Other proteins in same PDB: d1pv4a2, d1pv4a3, d1pv4b1, d1pv4b2, d1pv4c2, d1pv4c3, d1pv4d2, d1pv4d3, d1pv4e2, d1pv4e3, d1pv4f2, d1pv4f3

Details for d1pv4a1

PDB Entry: 1pv4 (more details), 3 Å

PDB Description: x-ray crystal structure of the rho transcription termination factor in complex with single stranded dna

SCOP Domain Sequences for d1pv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv4a1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d1pv4a1:

Click to download the PDB-style file with coordinates for d1pv4a1.
(The format of our PDB-style files is described here.)

Timeline for d1pv4a1: