Lineage for d1pv4d3 (1pv4 D:129-417)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314141Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 314340Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)
  7. 314341Species Escherichia coli [TaxId:562] [89677] (2 PDB entries)
  8. 314351Domain d1pv4d3: 1pv4 D:129-417 [88305]
    Other proteins in same PDB: d1pv4a1, d1pv4a2, d1pv4b1, d1pv4c1, d1pv4c2, d1pv4d1, d1pv4d2, d1pv4e1, d1pv4e2, d1pv4f1, d1pv4f2

Details for d1pv4d3

PDB Entry: 1pv4 (more details), 3 Å

PDB Description: x-ray crystal structure of the rho transcription termination factor in complex with single stranded dna

SCOP Domain Sequences for d1pv4d3:

Sequence, based on SEQRES records: (download)

>d1pv4d3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli}
nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll
qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie
kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve
eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke
ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records): (download)

>d1pv4d3 c.37.1.11 (D:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli}
nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia
qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr
lvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggslti
iatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqe
elqkmwilrkiihpmgeidameflinklamtktnddffemmk

SCOP Domain Coordinates for d1pv4d3:

Click to download the PDB-style file with coordinates for d1pv4d3.
(The format of our PDB-style files is described here.)

Timeline for d1pv4d3: