![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies) helix-extended loop-helix; parallel helices |
![]() | Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) ![]() |
![]() | Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein) |
![]() | Protein Rho termination factor, N-terminal domain [68914] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50295] (6 PDB entries) |
![]() | Domain d1pv4f1: 1pv4 F:1-47 [88309] Other proteins in same PDB: d1pv4a2, d1pv4a3, d1pv4b1, d1pv4b2, d1pv4c2, d1pv4c3, d1pv4d2, d1pv4d3, d1pv4e2, d1pv4e3, d1pv4f2, d1pv4f3 complexed with mse |
PDB Entry: 1pv4 (more details), 3 Å
SCOP Domain Sequences for d1pv4f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pv4f1 a.140.3.1 (F:1-47) Rho termination factor, N-terminal domain {Escherichia coli} mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge
Timeline for d1pv4f1: