Lineage for d1ovmd1 (1ovm D:181-341)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862632Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2862797Protein Indole-3-pyruvate decarboxylase [89637] (1 species)
  7. 2862798Species Enterobacter cloacae [TaxId:550] [89638] (1 PDB entry)
  8. 2862802Domain d1ovmd1: 1ovm D:181-341 [87470]
    Other proteins in same PDB: d1ovma2, d1ovma3, d1ovmb2, d1ovmb3, d1ovmc2, d1ovmc3, d1ovmd2, d1ovmd3
    complexed with mg, tpp

Details for d1ovmd1

PDB Entry: 1ovm (more details), 2.65 Å

PDB Description: Crystal structure of Indolepyruvate decarboxylase from Enterobacter cloacae
PDB Compounds: (D:) Indole-3-pyruvate decarboxylase

SCOPe Domain Sequences for d1ovmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovmd1 c.31.1.3 (D:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]}
nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
paqtievqphaarvgdvwftgipmnqaietlvelckqhvha

SCOPe Domain Coordinates for d1ovmd1:

Click to download the PDB-style file with coordinates for d1ovmd1.
(The format of our PDB-style files is described here.)

Timeline for d1ovmd1: