Lineage for d1ovmd2 (1ovm D:3-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2864566Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2864671Protein Indole-3-pyruvate decarboxylase [89648] (1 species)
  7. 2864672Species Enterobacter cloacae [TaxId:550] [89649] (1 PDB entry)
  8. 2864676Domain d1ovmd2: 1ovm D:3-180 [87471]
    Other proteins in same PDB: d1ovma1, d1ovma3, d1ovmb1, d1ovmb3, d1ovmc1, d1ovmc3, d1ovmd1, d1ovmd3
    complexed with mg, tpp

Details for d1ovmd2

PDB Entry: 1ovm (more details), 2.65 Å

PDB Description: Crystal structure of Indolepyruvate decarboxylase from Enterobacter cloacae
PDB Compounds: (D:) Indole-3-pyruvate decarboxylase

SCOPe Domain Sequences for d1ovmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovmd2 c.36.1.5 (D:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]}
tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv

SCOPe Domain Coordinates for d1ovmd2:

Click to download the PDB-style file with coordinates for d1ovmd2.
(The format of our PDB-style files is described here.)

Timeline for d1ovmd2: