PDB entry 1ovm

View 1ovm on RCSB PDB site
Description: Crystal structure of Indolepyruvate decarboxylase from Enterobacter cloacae
Class: lyase
Keywords: thiamine diphosphate, indole-3-acetic acid, indolepyruvate, tdp dependent enzyme, decarboxylase, LYASE
Deposited on 2003-03-27, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.205
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Indole-3-pyruvate decarboxylase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: ipdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ovma1, d1ovma2, d1ovma3
  • Chain 'B':
    Compound: Indole-3-pyruvate decarboxylase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: ipdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ovmb1, d1ovmb2, d1ovmb3
  • Chain 'C':
    Compound: Indole-3-pyruvate decarboxylase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: ipdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ovmc1, d1ovmc2, d1ovmc3
  • Chain 'D':
    Compound: Indole-3-pyruvate decarboxylase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: ipdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ovmd1, d1ovmd2, d1ovmd3
  • Heterogens: MG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ovmA (A:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmA (A:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ovmB (B:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmB (B:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ovmC (C:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmC (C:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ovmD (D:)
    mrtpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaad
    gyarckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgd
    gefrhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppv
    nalthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmah
    atmlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqlt
    paqtievqphaarvgdvwftgipmnqaietlvelckqhvhaglmssssgaipfpqpdgsl
    tqenfwrtlqtfirpgdiiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafga
    qtacpnrrvivltgdgaaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqrynd
    ialwnwthipqalsldpqsecwrvseaeqladvlekvahherlslievmlpkadippllg
    altkaleacnna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ovmD (D:)
    tpycvadylldrltdcgadhlfgvpgdynlqfldhvidspdicwvgcanelnasyaadgy
    arckgfaallttfgvgelsamngiagsyaehvpvlhivgapgtaaqqrgellhhtlgdge
    frhfyhmsepitvaqavlteqnacyeidrvlttmlrerrpgylmlpadvakkaatppvna
    lthkqahadsaclkafrdaaenklamskrtalladflvlrhglkhalqkwvkevpmahat
    mlmgkgifderqagfygtysgsastgavkeaiegadtvlcvgtrftdtltagfthqltpa
    qtievqphaarvgdvwftgipmnqaietlvelckqhvhapdgsltqenfwrtlqtfirpg
    diiladqgtsafgaidlrlpadvnfivqplwgsigytlaaafgaqtacpnrrvivltgdg
    aaqltiqelgsmlrdkqhpiilvlnnegytveraihgaeqryndialwnwthipqalsld
    pqsecwrvseaeqladvlekvahherlslievmlpkadippllgaltkaleacnn