| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) ![]() |
| Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins) |
| Protein Augmenter of liver regeneration [89018] (2 species) a mammalian FAD-dependent sulfhydryl oxidase |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry) |
| Domain d1oqcd_: 1oqc D: [87267] complexed with fad |
PDB Entry: 1oqc (more details), 1.8 Å
SCOPe Domain Sequences for d1oqcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqcd_ a.24.15.1 (D:) Augmenter of liver regeneration {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkr
idrsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc
Timeline for d1oqcd_: