SCOP 1.65: Domain d1oqcd_: 1oqc D:

Lineage for d1oqcd_ (1oqc D:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (1 family)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (2 proteins)

6. Protein Augmenter of liver regeneration [89018] (1 species)
   a mammalian FAD-dependent sulfhydryl oxidase

7. Species Rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry)

8. Domain d1oqcd_: 1oqc D: [87267]
   complexed with fad

Details for d1oqcd_

PDB Entry: 1oqc, 1.8 Å

PDB Description: The crystal structure of augmenter of liver regeneration: a mammalian FAD dependent sulfhydryl oxidase

SCOP Domain Sequences for d1oqcd_:

Sequence; same for both SEQRES and ATOM records:

>d1oqcd_ a.24.15.1 (D:) Augmenter of liver regeneration {Rat (Rattus norvegicus)}
edcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkr
idrsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

Timeline for d1oqcd_:

• d1oqcd_ is new in SCOP 1.65
  
• d1oqcd_ appears in SCOP 1.67
  
• d1oqcd_ appears in the current release, SCOPe 2.08