| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (1 family) ![]() |
| Family a.24.15.1: FAD-dependent thiol oxidase [69001] (2 proteins) |
| Protein Augmenter of liver regeneration [89018] (1 species) a mammalian FAD-dependent sulfhydryl oxidase |
| Species Rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry) |
| Domain d1oqcb_: 1oqc B: [87265] |
PDB Entry: 1oqc (more details), 1.8 Å
SCOP Domain Sequences for d1oqcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqcb_ a.24.15.1 (B:) Augmenter of liver regeneration {Rat (Rattus norvegicus)}
dcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkri
drsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc
Timeline for d1oqcb_: