SCOPe 2.07: Domain d1oqca_: 1oqc A:

Lineage for d1oqca_ (1oqc A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)

6. Protein Augmenter of liver regeneration [89018] (2 species)
   a mammalian FAD-dependent sulfhydryl oxidase

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry)

8. Domain d1oqca_: 1oqc A: [87264]
   complexed with fad

Details for d1oqca_

PDB Entry: 1oqc, 1.8 Å

PDB Description: The crystal structure of augmenter of liver regeneration: a mammalian FAD dependent sulfhydryl oxidase

PDB Compounds: (A:) Augmenter of liver regeneration

SCOPe Domain Sequences for d1oqca_:

Sequence; same for both SEQRES and ATOM records:

>d1oqca_ a.24.15.1 (A:) Augmenter of liver regeneration {Norway rat (Rattus norvegicus) [TaxId: 10116]}
edcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkr
idrsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

Timeline for d1oqca_:

• d1oqca_ first appeared in SCOP 1.65
  
• d1oqca_ appears in SCOPe 2.06
  
• d1oqca_ appears in the current release, SCOPe 2.08