Lineage for d1onfa2 (1onf A:154-270)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849979Protein Glutathione reductase, middle domain [418943] (3 species)
  7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [419399] (1 PDB entry)
  8. 2850016Domain d1onfa2: 1onf A:154-270 [87142]
    Other proteins in same PDB: d1onfa1, d1onfa3
    complexed with fad

Details for d1onfa2

PDB Entry: 1onf (more details), 2.6 Å

PDB Description: Crystal structure of Plasmodium falciparum Glutathione reductase
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d1onfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase, middle domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fppvkgientissdeffnikeskkigivgsgyiavelinvikrlgidsyifargnrilrk
fdesvinvlendmkknninivtfadvveikkvsdknlsihlsdgriyehfdhviycv

SCOPe Domain Coordinates for d1onfa2:

Click to download the PDB-style file with coordinates for d1onfa2.
(The format of our PDB-style files is described here.)

Timeline for d1onfa2: