PDB entry 1onf

View 1onf on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum Glutathione reductase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2003-02-27, released 2003-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.26
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione reductase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: GR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1onfa1, d1onfa2, d1onfa3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1onfA (A:)
    mvydlivigggsggmaaarraarhnakvalveksrlggtcvnvgcvpkkimfnaasvhdi
    lensrhygfdtkfsfnlpllverrdkyiqrlnniyrqnlskdkvdlyegtasflsenril
    ikgtkdnnnkdngplneeilegrniliavgnkpvfppvkgientissdeffnikeskkig
    ivgsgyiavelinvikrlgidsyifargnrilrkfdesvinvlendmkknninivtfadv
    veikkvsdknlsihlsdgriyehfdhviycvgrspdtenlkleklnvetnnnyivvdenq
    rtsvnniyavgdccmvkkskeiedlnllklyneerylnkkenvtedifynvqltpvaina
    grlladrlflkktrktnykliptvifshppigtiglseeaaiqiygkenvkiyeskftnl
    ffsvydiepelkektylklvcvgkdelikglhiiglnadeivqgfavalkmnatkkdfde
    tipihptaaeefltlqpwmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1onfA (A:)
    vydlivigggsggmaaarraarhnakvalveksrlggtcvnvgcvpkkimfnaasvhdil
    ensrhygfdtkfsfnlpllverrdkyiqrlnniyrqnlskdkvdlyegtasflegrnili
    avgnkpvfppvkgientissdeffnikeskkigivgsgyiavelinvikrlgidsyifar
    gnrilrkfdesvinvlendmkknninivtfadvveikkvsdknlsihlsdgriyehfdhv
    iycvgrspdtenlkleklnvetnnnyivvdenqrtsvnniyavgdccmvkfynvqltpva
    inagrlladrlflkktrktnykliptvifshppigtiglseeaaiqiygkenvkiyeskf
    tnlffsvydiepelkektylklvcvgkdelikglhiiglnadeivqgfavalkmnatkkd
    fdetipihptaaeefltlq