Lineage for d1onfa2 (1onf A:154-270)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309374Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 309375Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 309632Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 309693Protein Glutathione reductase [51944] (3 species)
  7. 309746Species Plasmodium falciparum [89548] (1 PDB entry)
  8. 309748Domain d1onfa2: 1onf A:154-270 [87142]
    Other proteins in same PDB: d1onfa3
    complexed with fad

Details for d1onfa2

PDB Entry: 1onf (more details), 2.6 Å

PDB Description: Crystal structure of Plasmodium falciparum Glutathione reductase

SCOP Domain Sequences for d1onfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum}
fppvkgientissdeffnikeskkigivgsgyiavelinvikrlgidsyifargnrilrk
fdesvinvlendmkknninivtfadvveikkvsdknlsihlsdgriyehfdhviycv

SCOP Domain Coordinates for d1onfa2:

Click to download the PDB-style file with coordinates for d1onfa2.
(The format of our PDB-style files is described here.)

Timeline for d1onfa2: