![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Glutathione reductase [51944] (3 species) |
![]() | Species Plasmodium falciparum [89548] (1 PDB entry) |
![]() | Domain d1onfa2: 1onf A:154-270 [87142] Other proteins in same PDB: d1onfa3 complexed with fad |
PDB Entry: 1onf (more details), 2.6 Å
SCOP Domain Sequences for d1onfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum} fppvkgientissdeffnikeskkigivgsgyiavelinvikrlgidsyifargnrilrk fdesvinvlendmkknninivtfadvveikkvsdknlsihlsdgriyehfdhviycv
Timeline for d1onfa2: