SCOPe 2.08: Domain d1o3yb1: 1o3y B:18-181

Lineage for d1o3yb1 (1o3y B:18-181)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (17 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
   Uniprot P32889

8. Domain d1o3yb1: 1o3y B:18-181 [86619]
   Other proteins in same PDB: d1o3ya2, d1o3yb2
   complexed with gtp, mg

Details for d1o3yb1

PDB Entry: 1o3y, 1.5 Å

PDB Description: crystal structure of mouse arf1 (delta17-q71l), gtp form

PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1o3yb1:

Sequence; same for both SEQRES and ATOM records:

>d1o3yb1 c.37.1.8 (B:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

Timeline for d1o3yb1:

• d1o3yb1 first appeared in SCOP 1.65, called d1o3yb_
  
• d1o3yb1 appears in SCOPe 2.07