Lineage for d1o3yb_ (1o3y B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313510Family c.37.1.8: G proteins [52592] (35 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 313511Protein ADP-ribosylation factor [52614] (7 species)
  7. 313517Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (3 PDB entries)
  8. 313519Domain d1o3yb_: 1o3y B: [86619]
    complexed with gtp, mg; mutant

Details for d1o3yb_

PDB Entry: 1o3y (more details), 1.5 Å

PDB Description: Crystal structure of mouse ARF1 (delta17-Q71L), GTP form
PDB Compounds: (B:)

SCOP Domain Sequences for d1o3yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o3yb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF1}
gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

SCOP Domain Coordinates for d1o3yb_:

Click to download the PDB-style file with coordinates for d1o3yb_.
(The format of our PDB-style files is described here.)

Timeline for d1o3yb_: