Lineage for d1nw9a_ (1nw9 A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067283Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1067284Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 1067285Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1067331Protein BIR domains of XIAP [57928] (1 species)
  7. 1067332Species Human (Homo sapiens) [TaxId:9606] [57929] (14 PDB entries)
    Uniprot P98170 241-356
  8. 1067336Domain d1nw9a_: 1nw9 A: [86293]
    Other proteins in same PDB: d1nw9b_
    BIR3 domain complexed to caspase 9
    complexed with zn

Details for d1nw9a_

PDB Entry: 1nw9 (more details), 2.4 Å

PDB Description: structure of caspase-9 in an inhibitory complex with xiap-bir3
PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1nw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw9a_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
pweqhakwypgckylleqkgqeyinnihlth

SCOPe Domain Coordinates for d1nw9a_:

Click to download the PDB-style file with coordinates for d1nw9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nw9a_: