![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins) |
![]() | Protein BIR domains of XIAP [57928] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57929] (11 PDB entries) Uniprot P98170 241-356 |
![]() | Domain d1nw9a_: 1nw9 A: [86293] Other proteins in same PDB: d1nw9b_ BIR3 domain complexed to caspase 9 complexed with zn |
PDB Entry: 1nw9 (more details), 2.4 Å
SCOP Domain Sequences for d1nw9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nw9a_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed pweqhakwypgckylleqkgqeyinnihlth
Timeline for d1nw9a_: