![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Hexameric traffic ATPase, HP0525 [52719] (1 species) type II/IV secretion system protein; includes N-terminal alpha+beta domain of a profilin-like topology |
![]() | Species Helicobacter pylori [TaxId:210] [52720] (5 PDB entries) |
![]() | Domain d1nlze_: 1nlz E: [85864] has additional subdomain(s) that are not in the common domain |
PDB Entry: 1nlz (more details), 3 Å
SCOPe Domain Sequences for d1nlze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nlze_ c.37.1.11 (E:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} alnplrhateelfgdflkmeniteicyngnkvvwvlknngewqpfdvrdrkafslsrlmh farccasfkkktidnyenpilssnlangervqivlspvtvndetisisiripskttyphs ffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkttyiksimefipkeeriis iedteeivfkhhknytqlffggnitsadclksclrmrpdriilgelrsseaydfynvlcs ghkgtlttlhagsseeafirlanmsssnsaarnikfesliegfkdlidmivhinhhkqcd efyik
Timeline for d1nlze_: