Lineage for d1nlze_ (1nlz E:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314141Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 314310Protein Hexameric traffic ATPase, HP0525 [52719] (1 species)
    includes N-terminal alpha+beta domain of a profilin-like topology
  7. 314311Species Helicobacter pylori [TaxId:210] [52720] (4 PDB entries)
  8. 314322Domain d1nlze_: 1nlz E: [85864]

Details for d1nlze_

PDB Entry: 1nlz (more details), 3 Å

PDB Description: Crystal structure of unliganded traffic ATPase of the type IV secretion system of helicobacter pylori

SCOP Domain Sequences for d1nlze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlze_ c.37.1.11 (E:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori}
alnplrhateelfgdflkmeniteicyngnkvvwvlknngewqpfdvrdrkafslsrlmh
farccasfkkktidnyenpilssnlangervqivlspvtvndetisisiripskttyphs
ffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkttyiksimefipkeeriis
iedteeivfkhhknytqlffggnitsadclksclrmrpdriilgelrsseaydfynvlcs
ghkgtlttlhagsseeafirlanmsssnsaarnikfesliegfkdlidmivhinhhkqcd
efyik

SCOP Domain Coordinates for d1nlze_:

Click to download the PDB-style file with coordinates for d1nlze_.
(The format of our PDB-style files is described here.)

Timeline for d1nlze_: