SCOPe 2.07: Domain d1ngna_: 1ngn A:

Lineage for d1ngna_ (1ngn A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)

6. Protein Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 [89099] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89100] (1 PDB entry)

8. Domain d1ngna_: 1ngn A: [85697]

Details for d1ngna_

PDB Entry: 1ngn, 2.1 Å

PDB Description: mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4

PDB Compounds: (A:) methyl-CpG binding protein MBD4

SCOPe Domain Sequences for d1ngna_:

Sequence; same for both SEQRES and ATOM records:

>d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]}
kwtpprspfnlvqeilfhdpwklliatiflnrtsgkmaipvlweflekypsaevaraadw
rdvsellkplglydlraktiikfsdeyltkqwrypielhgigkygndsyrifcvnewkqv
hpedhklnkyhdwlwenheklsls

Timeline for d1ngna_:

• d1ngna_ first appeared in SCOP 1.65
  
• d1ngna_ appears in SCOPe 2.06
  
• d1ngna_ appears in the current release, SCOPe 2.08