Lineage for d1ngna_ (1ngn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2720988Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2721010Protein Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 [89099] (1 species)
  7. 2721011Species Mouse (Mus musculus) [TaxId:10090] [89100] (1 PDB entry)
  8. 2721012Domain d1ngna_: 1ngn A: [85697]

Details for d1ngna_

PDB Entry: 1ngn (more details), 2.1 Å

PDB Description: mismatch repair in methylated dna. structure of the mismatch-specific thymine glycosylase domain of methyl-cpg-binding protein mbd4
PDB Compounds: (A:) methyl-CpG binding protein MBD4

SCOPe Domain Sequences for d1ngna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]}
kwtpprspfnlvqeilfhdpwklliatiflnrtsgkmaipvlweflekypsaevaraadw
rdvsellkplglydlraktiikfsdeyltkqwrypielhgigkygndsyrifcvnewkqv
hpedhklnkyhdwlwenheklsls

SCOPe Domain Coordinates for d1ngna_:

Click to download the PDB-style file with coordinates for d1ngna_.
(The format of our PDB-style files is described here.)

Timeline for d1ngna_: