PDB entry 1ngn

View 1ngn on RCSB PDB site
Description: Mismatch repair in methylated DNA. Structure of the mismatch-specific thymine glycosylase domain of methyl-CpG-binding protein MBD4
Class: DNA binding protein
Keywords: mismacth repair in methylated DNA, DNA BINDING PROTEIN
Deposited on 2002-12-17, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-CpG binding protein MBD4
    Species: Mus musculus [TaxId:10090]
    Gene: Mbd4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ngnA (A:)
    alspprrksfkkwtpprspfnlvqeilfhdpwklliatiflnrtsgkmaipvlwefleky
    psaevaraadwrdvsellkplglydlraktiikfsdeyltkqwrypielhgigkygndsy
    rifcvnewkqvhpedhklnkyhdwlwenheklsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngnA (A:)
    kwtpprspfnlvqeilfhdpwklliatiflnrtsgkmaipvlweflekypsaevaraadw
    rdvsellkplglydlraktiikfsdeyltkqwrypielhgigkygndsyrifcvnewkqv
    hpedhklnkyhdwlwenheklsls