| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
| Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins) |
| Protein Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 [89099] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [89100] (1 PDB entry) |
| Domain d1ngna_: 1ngn A: [85697] |
PDB Entry: 1ngn (more details), 2.1 Å
SCOPe Domain Sequences for d1ngna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]}
kwtpprspfnlvqeilfhdpwklliatiflnrtsgkmaipvlweflekypsaevaraadw
rdvsellkplglydlraktiikfsdeyltkqwrypielhgigkygndsyrifcvnewkqv
hpedhklnkyhdwlwenheklsls
Timeline for d1ngna_: