Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.129: TBP-like [55944] (8 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (6 PDB entries) |
Domain d1ngmm2: 1ngm M:156-240 [85695] Other proteins in same PDB: d1ngmb_, d1ngmf_, d1ngmj_, d1ngmn_ a ternary complex with DNA and Brf1 peptide |
PDB Entry: 1ngm (more details), 2.95 Å
SCOP Domain Sequences for d1ngmm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngmm2 d.129.1.1 (M:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt gakqreeiyqafeaiypvlsefrkm
Timeline for d1ngmm2: