SCOP 1.69: Domain d1ngma2: 1ngm A:156-240

Lineage for d1ngma2 (1ngm A:156-240)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.129: TBP-like [55944] (8 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (6 PDB entries)

8. Domain d1ngma2: 1ngm A:156-240 [85686]
   Other proteins in same PDB: d1ngmb_, d1ngmf_, d1ngmj_, d1ngmn_

Details for d1ngma2

PDB Entry: 1ngm, 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex

SCOP Domain Sequences for d1ngma2:

Sequence; same for both SEQRES and ATOM records:

>d1ngma2 d.129.1.1 (A:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

Timeline for d1ngma2:

• d1ngma2 first appeared in SCOP 1.65
  
• d1ngma2 appears in SCOP 1.67
  
• d1ngma2 appears in SCOP 1.71
  
• d1ngma2 appears in the current release, SCOPe 2.08