Lineage for d1ngmn_ (1ngm N:)

  1. Root: SCOP 1.69
  2. 528313Class j: Peptides [58231] (116 folds)
  3. 529789Fold j.104: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90297] (1 superfamily)
  4. 529790Superfamily j.104.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90298] (1 family) (S)
  5. 529791Family j.104.1.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90299] (1 protein)
  6. 529792Protein TBP-binding domain of the transcription factor IIIb Brf1 subunit [90300] (1 species)
  7. 529793Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90301] (1 PDB entry)
  8. 529797Domain d1ngmn_: 1ngm N: [85696]
    Other proteins in same PDB: d1ngma1, d1ngma2, d1ngme1, d1ngme2, d1ngmi1, d1ngmi2, d1ngmm1, d1ngmm2

Details for d1ngmn_

PDB Entry: 1ngm (more details), 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex

SCOP Domain Sequences for d1ngmn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngmn_ j.104.1.1 (N:) TBP-binding domain of the transcription factor IIIb Brf1 subunit {Baker's yeast (Saccharomyces cerevisiae)}
kvsddpdnledvddeelnahllneeasklkeriwiglnadflleqeskrlkqe

SCOP Domain Coordinates for d1ngmn_:

Click to download the PDB-style file with coordinates for d1ngmn_.
(The format of our PDB-style files is described here.)

Timeline for d1ngmn_: