SCOPe 2.08: Domain d1ngmm2: 1ngm M:156-240

Lineage for d1ngmm2 (1ngm M:156-240)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats
   automatically mapped to Pfam PF00352

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
   structure of the N-terminal domain is not known yet

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)

8. Domain d1ngmm2: 1ngm M:156-240 [85695]
   Other proteins in same PDB: d1ngmb1, d1ngmb2, d1ngmf1, d1ngmf2, d1ngmj_, d1ngmn_
   a ternary complex with DNA and Brf1 peptide
   protein/DNA complex

Details for d1ngmm2

PDB Entry: 1ngm, 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex

PDB Compounds: (M:) Transcription initiation factor TFIID

SCOPe Domain Sequences for d1ngmm2:

Sequence; same for both SEQRES and ATOM records:

>d1ngmm2 d.129.1.1 (M:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

Timeline for d1ngmm2:

• d1ngmm2 first appeared in SCOP 1.65
  
• d1ngmm2 appears in SCOPe 2.07