SCOPe 2.08: Domain d1lx5a_: 1lx5 A:

Lineage for d1lx5a_ (1lx5 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57515] (4 PDB entries)

8. Domain d1lx5a_: 1lx5 A: [84732]
   Other proteins in same PDB: d1lx5b_
   complexed with the extracellular domain of activin type II receptor
   complexed with nag

Details for d1lx5a_

PDB Entry: 1lx5, 3.3 Å

PDB Description: crystal structure of the bmp7/actrii extracellular domain complex

PDB Compounds: (A:) bone morphogenetic protein 7

SCOPe Domain Sequences for d1lx5a_:

Sequence; same for both SEQRES and ATOM records:

>d1lx5a_ g.17.1.2 (A:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens) [TaxId: 9606]}
qackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaivqtlvhfin
petvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

Timeline for d1lx5a_:

• d1lx5a_ first appeared in SCOP 1.65
  
• d1lx5a_ appears in SCOPe 2.07