PDB entry 1lx5

View 1lx5 on RCSB PDB site
Description: Crystal Structure of the BMP7/ActRII Extracellular Domain Complex
Class: growth factor/growth factor receptor
Keywords: ligand-receptor complex, growth factor-growth factor receptor complex
Deposited on 2002-06-04, released 2003-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bone morphogenetic protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lx5a_
  • Chain 'B':
    Compound: Activin Type II Receptor
    Species: Mus musculus [TaxId:10090]
    Gene: ACVR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lx5b_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lx5A (A:)
    stgskqrsqnrsktpknqealrmanvaensssdqrqackkhelyvsfrdlgwqdwiiape
    gyaayycegecafplnsymnatnhaivqtlvhfinpetvpkpccaptqlnaisvlyfdds
    snvilkkyrnmvvracgch
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lx5A (A:)
    qackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaivqtlvhfin
    petvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lx5B (B:)
    ailgrsetqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcw
    lddincydrtdciekkdspevyfcccegnmcnekfsyfpeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lx5B (B:)
    etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
    ydrtdciekkdspevyfcccegnmcnekfsyfpe