Lineage for d1lx5a_ (1lx5 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638467Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)
  7. 2638468Species Human (Homo sapiens) [TaxId:9606] [57515] (4 PDB entries)
  8. 2638472Domain d1lx5a_: 1lx5 A: [84732]
    Other proteins in same PDB: d1lx5b_
    complexed with the extracellular domain of activin type II receptor
    complexed with nag, ndg

Details for d1lx5a_

PDB Entry: 1lx5 (more details), 3.3 Å

PDB Description: crystal structure of the bmp7/actrii extracellular domain complex
PDB Compounds: (A:) bone morphogenetic protein 7

SCOPe Domain Sequences for d1lx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lx5a_ g.17.1.2 (A:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens) [TaxId: 9606]}
qackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaivqtlvhfin
petvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

SCOPe Domain Coordinates for d1lx5a_:

Click to download the PDB-style file with coordinates for d1lx5a_.
(The format of our PDB-style files is described here.)

Timeline for d1lx5a_: