Lineage for d1lv5a2 (1lv5 A:469-876)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622072Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2622073Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (44 PDB entries)
    Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
    Uniprot Q45458 298-876 # 88% sequence identity
  8. 2622108Domain d1lv5a2: 1lv5 A:469-876 [84720]
    Other proteins in same PDB: d1lv5a1, d1lv5b1
    protein/DNA complex; complexed with dcp, mg, mn, so4

Details for d1lv5a2

PDB Entry: 1lv5 (more details), 1.95 Å

PDB Description: Crystal Structure of the Closed Conformation of Bacillus DNA Polymerase I Fragment Bound to DNA and dCTP
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1lv5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lv5a2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nfgivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

SCOPe Domain Coordinates for d1lv5a2:

Click to download the PDB-style file with coordinates for d1lv5a2.
(The format of our PDB-style files is described here.)

Timeline for d1lv5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lv5a1