![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
![]() | Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (43 PDB entries) Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462 |
![]() | Domain d1lv5a1: 1lv5 A:297-468 [84719] Other proteins in same PDB: d1lv5a2, d1lv5b2 protein/DNA complex; complexed with dcp, mg, mn, so4 |
PDB Entry: 1lv5 (more details), 1.95 Å
SCOPe Domain Sequences for d1lv5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lv5a1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} akmaftladrvteemladkaalvvevveenyhaapivgiavvnehgrfflrpetaladpq fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d1lv5a1: