Lineage for d1jreh_ (1jre H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701766Species Escherichia coli, Dps [TaxId:562] [47251] (8 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 2701810Domain d1jreh_: 1jre H: [84200]
    protein/DNA complex; complexed with cd, trs

Details for d1jreh_

PDB Entry: 1jre (more details), 2.65 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (H:) DNA protection during starvation protein

SCOPe Domain Sequences for d1jreh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jreh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
dvrkaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1jreh_:

Click to download the PDB-style file with coordinates for d1jreh_.
(The format of our PDB-style files is described here.)

Timeline for d1jreh_: