Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1jref_ (1jre F:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein Dodecameric ferritin homolog [47250] (14 species)
  7. Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. Domain d1jref_: 1jre F: [84198]
    protein/DNA complex; complexed with cd, trs

Details for d1jref_

PDB Entry: 1jre (more details)
PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (F:) DNA protection during starvation protein

SCOP Domain Sequences for d1jref_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jref_ a.25.1.1 (F:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1jref_:

Click to download the PDB-style file with coordinates for d1jref_.
(The format of our PDB-style files is described here.)

Timeline for d1jref_:

d1jref_ appears in SCOP 1.75A


d1jref_
(click for larger image)


d1jref_ in context of chain



d1jref_ in context of PDB
Domains from other chains:
d1jrea_, d1jreb_, d1jrec_, d1jred_, d1jree_, d1jreg_, d1jreh_, d1jrei_, d1jrej_, d1jrek_, d1jrel_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu