Lineage for d1o9sb1 (1o9s B:117-193)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234136Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 234144Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 234145Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 234146Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 234147Species Human (Homo sapiens) [TaxId:9606] [82188] (6 PDB entries)
  8. 234153Domain d1o9sb1: 1o9s B:117-193 [81251]
    Other proteins in same PDB: d1o9sa2, d1o9sb2
    truncated from N-terminus
    complexed with mlz, sah

Details for d1o9sb1

PDB Entry: 1o9s (more details), 1.75 Å

PDB Description: crystal structure of a ternary complex of the human histone methyltransferase set7/9

SCOP Domain Sequences for d1o9sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9sb1 b.76.2.1 (B:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens)}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

SCOP Domain Coordinates for d1o9sb1:

Click to download the PDB-style file with coordinates for d1o9sb1.
(The format of our PDB-style files is described here.)

Timeline for d1o9sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o9sb2