Class b: All beta proteins [48724] (119 folds) |
Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) 11+ stranded sheet partly folded upon itself at the C-end |
Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein) |
Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82188] (6 PDB entries) |
Domain d1o9sb1: 1o9s B:117-193 [81251] Other proteins in same PDB: d1o9sa2, d1o9sb2 truncated from N-terminus complexed with mlz, sah |
PDB Entry: 1o9s (more details), 1.75 Å
SCOP Domain Sequences for d1o9sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9sb1 b.76.2.1 (B:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens)} gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste egrphfelmpgnsvyhf
Timeline for d1o9sb1: