Lineage for d1o9sb2 (1o9s B:194-366)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235002Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 235137Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 235138Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET and postSET domains
  6. 235142Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 235143Species Human (Homo sapiens) [TaxId:9606] [82206] (6 PDB entries)
  8. 235149Domain d1o9sb2: 1o9s B:194-366 [81252]
    Other proteins in same PDB: d1o9sa1, d1o9sb1
    complexed with mlz, sah

Details for d1o9sb2

PDB Entry: 1o9s (more details), 1.75 Å

PDB Description: crystal structure of a ternary complex of the human histone methyltransferase set7/9

SCOP Domain Sequences for d1o9sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9sb2 b.85.7.1 (B:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens)}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk

SCOP Domain Coordinates for d1o9sb2:

Click to download the PDB-style file with coordinates for d1o9sb2.
(The format of our PDB-style files is described here.)

Timeline for d1o9sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o9sb1