Lineage for d1o9sb1 (1o9s B:117-193)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2068816Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2068846Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2068847Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2068848Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2068849Species Human (Homo sapiens) [TaxId:9606] [82188] (18 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2068874Domain d1o9sb1: 1o9s B:117-193 [81251]
    Other proteins in same PDB: d1o9sa2, d1o9sb2
    truncated from N-terminus
    complexed with sah

Details for d1o9sb1

PDB Entry: 1o9s (more details), 1.75 Å

PDB Description: crystal structure of a ternary complex of the human histone methyltransferase set7/9
PDB Compounds: (B:) histone-lysine n-methyltransferase, h3 lysine-4 specific

SCOPe Domain Sequences for d1o9sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9sb1 b.76.2.1 (B:117-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
egrphfelmpgnsvyhf

SCOPe Domain Coordinates for d1o9sb1:

Click to download the PDB-style file with coordinates for d1o9sb1.
(The format of our PDB-style files is described here.)

Timeline for d1o9sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o9sb2