SCOPe 2.02: Domain d1o94f

Lineage for d1o94f_ (1o94 F:)

Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)

share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

Family c.26.2.3: ETFP subunits [52432] (3 proteins)
alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
contains an additional FAD-binding domain of DHS-like fold
Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)
Domain d1o94f_: 1o94 F: [81209]
Other proteins in same PDB: d1o94a1, d1o94a2, d1o94a3, d1o94b1, d1o94b2, d1o94b3, d1o94c_, d1o94e_
complexed with adp, amp, fmn, sf4

Details for d1o94f_

PDB Entry: 1o94 (more details), 2 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein

PDB Compounds: (F:) electron transfer flavoprotein alpha-subunit

SCOPe Domain Sequences for d1o94f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o94f_ c.26.2.3 (F:) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyv

SCOPe Domain Coordinates for d1o94f_:

Click to download the PDB-style file with coordinates for d1o94f_.
(The format of our PDB-style files is described here.)

Timeline for d1o94f_: