SCOPe 2.02: Domain d1o94e_: 1o94 E:

Lineage for d1o94e_ (1o94 E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
   binds AMP

7. Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)

8. Domain d1o94e_: 1o94 E: [81208]
   Other proteins in same PDB: d1o94a1, d1o94a2, d1o94a3, d1o94b1, d1o94b2, d1o94b3, d1o94d_, d1o94f_
   complexed with adp, amp, fmn, sf4

Details for d1o94e_

PDB Entry: 1o94, 2 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein

PDB Compounds: (E:) Electron transfer flavoprotein beta-subunit

SCOPe Domain Sequences for d1o94e_:

Sequence; same for both SEQRES and ATOM records:

>d1o94e_ c.26.2.3 (E:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipe

Timeline for d1o94e_:

• d1o94e_ first appeared in SCOP 1.63
  
• d1o94e_ appears in SCOPe 2.01
  
• d1o94e_ appears in SCOPe 2.03
  
• d1o94e_ appears in the current release, SCOPe 2.08