Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species) binds AMP |
Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries) |
Domain d1o94c_: 1o94 C: [81206] Other proteins in same PDB: d1o94a1, d1o94a2, d1o94a3, d1o94b1, d1o94b2, d1o94b3, d1o94d_, d1o94f_ complexed with adp, amp, fmn, sf4 |
PDB Entry: 1o94 (more details), 2 Å
SCOPe Domain Sequences for d1o94c_:
Sequence, based on SEQRES records: (download)
>d1o94c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyip
>d1o94c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} mkilvavkqtaaleedfeirdgmdvdedfmmydlnewddfsleeamkikessddvevvvv svgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagvqs sdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavlti qlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyip
Timeline for d1o94c_: