Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins) |
Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species) N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold |
Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries) |
Domain d1o94b2: 1o94 B:490-645 [81204] Other proteins in same PDB: d1o94a1, d1o94a3, d1o94b1, d1o94b3, d1o94c_, d1o94d_, d1o94e_, d1o94f_ complexed with adp, amp, fmn, sf4 |
PDB Entry: 1o94 (more details), 2 Å
SCOPe Domain Sequences for d1o94b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o94b2 c.3.1.1 (B:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg dgskrtyrgpgvsprdantshrwiefdslvlvtgrh
Timeline for d1o94b2: