SCOPe 2.05: Domain d1n7sa_: 1n7s A:

Lineage for d1n7sa_ (1n7s A:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Synaptobrevin [88903] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (4 PDB entries)

8. Domain d1n7sa_: 1n7s A: [80271]
   Other proteins in same PDB: d1n7sb_, d1n7sc_, d1n7sd_
   complex with syntaxin and SNAP-25 fragments
   complexed with ca, mpd

Details for d1n7sa_

PDB Entry: 1n7s, 1.45 Å

PDB Description: high resolution structure of a truncated neuronal snare complex

PDB Compounds: (A:) vesicle-associated membrane protein 2

SCOPe Domain Sequences for d1n7sa_:

Sequence; same for both SEQRES and ATOM records:

>d1n7sa_ h.1.15.1 (A:) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkr
kyw

Timeline for d1n7sa_:

• d1n7sa_ first appeared in SCOP 1.63
  
• d1n7sa_ appears in SCOPe 2.04
  
• d1n7sa_ is called d1n7sa1 in SCOPe 2.06
  
• d1n7sa_ appears in the current release, SCOPe 2.08, called d1n7sa1