Lineage for d1n7sa1 (1n7s A:28-89)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040219Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 3040220Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 3040233Protein Synaptobrevin [88903] (3 species)
  7. 3040240Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (4 PDB entries)
  8. 3040241Domain d1n7sa1: 1n7s A:28-89 [80271]
    Other proteins in same PDB: d1n7sa2, d1n7sb1, d1n7sb2, d1n7sc1, d1n7sc2, d1n7sd1, d1n7sd2
    complex with syntaxin and SNAP-25 fragments
    complexed with ca, mpd

Details for d1n7sa1

PDB Entry: 1n7s (more details), 1.45 Å

PDB Description: high resolution structure of a truncated neuronal snare complex
PDB Compounds: (A:) vesicle-associated membrane protein 2

SCOPe Domain Sequences for d1n7sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7sa1 h.1.15.1 (A:28-89) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
yw

SCOPe Domain Coordinates for d1n7sa1:

Click to download the PDB-style file with coordinates for d1n7sa1.
(The format of our PDB-style files is described here.)

Timeline for d1n7sa1: