Lineage for d1n7sa_ (1n7s A:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709021Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 1709022Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 1709035Protein Synaptobrevin [88903] (3 species)
  7. 1709041Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (3 PDB entries)
  8. 1709042Domain d1n7sa_: 1n7s A: [80271]
    Other proteins in same PDB: d1n7sb_, d1n7sc_, d1n7sd_
    complex with syntaxin and SNAP-25 fragments
    complexed with ca, mpd

Details for d1n7sa_

PDB Entry: 1n7s (more details), 1.45 Å

PDB Description: high resolution structure of a truncated neuronal snare complex
PDB Compounds: (A:) vesicle-associated membrane protein 2

SCOPe Domain Sequences for d1n7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7sa_ h.1.15.1 (A:) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkr
kyw

SCOPe Domain Coordinates for d1n7sa_:

Click to download the PDB-style file with coordinates for d1n7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1n7sa_: