PDB entry 1n7s

View 1n7s on RCSB PDB site
Description: High Resolution Structure of a Truncated Neuronal SNARE Complex
Class: Transport protein
Keywords: neuronal SNARE protein complex, four helix bundle, Transport protein
Deposited on 2002-11-16, released 2002-12-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.198
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vesicle-associated membrane protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63045 (0-61)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d1n7sa_
  • Chain 'B':
    Compound: syntaxin 1a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32851 (2-67)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d1n7sb_
  • Chain 'C':
    Compound: snap-25a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60881 (2-78)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d1n7sc_
  • Chain 'D':
    Compound: snap-25a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60881 (2-65)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d1n7sd_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sA (A:)
    gsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkr
    kyw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sB (B:)
    gsalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
    sdtkkavk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sC (C:)
    gsmrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegm
    nhinqdmkeaeknlkdlgk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7sD (D:)
    gsarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktrideanqr
    atkmlg