SCOPe 2.05: Domain d1me5c_: 1me5 C:

Lineage for d1me5c_ (1me5 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.1: AhpD [69119] (2 proteins)
   duplication: two-domain subunits form a helix-swapped trimer

6. Protein Antioxidant defense protein AhpD [69120] (1 species)
   a novel enzyme with thioredoxin-like activity

7. Species Mycobacterium tuberculosis [TaxId:1773] [69121] (4 PDB entries)

8. Domain d1me5c_: 1me5 C: [79026]
   mutant

Details for d1me5c_

PDB Entry: 1me5, 2.4 Å

PDB Description: crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant

PDB Compounds: (C:) alkylhydroperoxidase d

SCOPe Domain Sequences for d1me5c_:

Sequence; same for both SEQRES and ATOM records:

>d1me5c_ a.152.1.1 (C:) Antioxidant defense protein AhpD {Mycobacterium tuberculosis [TaxId: 1773]}
ieklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdh
lsaaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsf
avsaingcsqclvahehtlrtvgvdreaifealkaaaivsgvaqalati

Timeline for d1me5c_:

• d1me5c_ first appeared in SCOP 1.63
  
• d1me5c_ appears in SCOPe 2.04
  
• d1me5c_ appears in SCOPe 2.06
  
• d1me5c_ appears in the current release, SCOPe 2.08