Lineage for d1me5c_ (1me5 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506940Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 1506941Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 1506942Family a.152.1.1: AhpD [69119] (2 proteins)
    duplication: two-domain subunits form a helix-swapped trimer
  6. 1506943Protein Antioxidant defense protein AhpD [69120] (1 species)
    a novel enzyme with thioredoxin-like activity
  7. 1506944Species Mycobacterium tuberculosis [TaxId:1773] [69121] (4 PDB entries)
  8. 1506965Domain d1me5c_: 1me5 C: [79026]
    mutant

Details for d1me5c_

PDB Entry: 1me5 (more details), 2.4 Å

PDB Description: crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant
PDB Compounds: (C:) alkylhydroperoxidase d

SCOPe Domain Sequences for d1me5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1me5c_ a.152.1.1 (C:) Antioxidant defense protein AhpD {Mycobacterium tuberculosis [TaxId: 1773]}
ieklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdh
lsaaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsf
avsaingcsqclvahehtlrtvgvdreaifealkaaaivsgvaqalati

SCOPe Domain Coordinates for d1me5c_:

Click to download the PDB-style file with coordinates for d1me5c_.
(The format of our PDB-style files is described here.)

Timeline for d1me5c_: